IFI30 Rabbit Polyclonal Antibody

CAT#: TA338132

Rabbit Polyclonal Anti-IFI30 Antibody

Product Images

WB Suggested Anti-IFI30 Antibody; Titration: 1.0 ug/ml; Positive Control: Hela Whole Cell IFI30 is supported by BioGPS gene expression data to be expressed in HeLa

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-IFI30 antibody is: synthetic peptide directed towards the middle region of Human IFI30. Synthetic peptide located within the following region: YGNAQEQNVSGRWEFKCQHGEEECKFNKVEACVLDELDMELAFLTIVCME
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 20 kDa
• Gene Name: IFI30, lysosomal thiol reductase
• Database Link:
  NP_006323
  Entrez Gene 10437 Human
  UniProt ID P13284
• Background: The protein encoded by this gene is a lysosomal thiol reductase that at low pH can reduce protein disulfide bonds. The enzyme is expressed constitutively in antigen-presenting cells and induced by gamma-interferon in other cell types. This enzyme has an important role in MHC class II-restricted antigen processing.
• Synonyms: GILT; IFI-30; IP-30; IP30
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 86%; Horse: 86%; Mouse: 86%; Sheep: 86%; Bovine: 86%

Reference Data

• Protein Pathways: Antigen processing and presentation