Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal antibody to IFIT3 (interferon-induced protein with tetratricopeptide repeats 3)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 230 and 490 of IFIT3 (Uniprot ID#O14879) |
Rabbit Polyclonal IFIT3 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal Anti-IFIT3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IFIT3 antibody: synthetic peptide directed towards the N terminal of human IFIT3. Synthetic peptide located within the following region: ATMYNLLAYIKHLDGNNEAALECLRQAEELIQQEHADQAEIRSLVTWGNY |
Carrier-free (BSA/glycerol-free) IFIT3 mouse monoclonal antibody, clone OTI1G1 (formerly 1G1)
| Applications | FC, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
IFIT3 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human IFIT3 |
IFIT3 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human IFIT3 |
IFIT3 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 291-490 of human IFIT3 (NP_001540.2). |
| Modifications | Unmodified |
IFIT3 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of mouse IFIT3 |
| Modifications | Unmodified |
IFIT3 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 128-331 of mouse IFIT3 (NP_034631.1). |
| Modifications | Unmodified |
Anti-IFIT3 mouse monoclonal antibody, clone OTI1G1 (formerly 1G1)
| Applications | FC, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
Anti-IFIT3 mouse monoclonal antibody, clone OTI1G1 (formerly 1G1), Biotinylated
| Applications | FC, IF, WB |
| Reactivities | Human |
| Conjugation | Biotin |
Anti-IFIT3 mouse monoclonal antibody, clone OTI1G1 (formerly 1G1), HRP conjugated
| Applications | FC, IF, WB |
| Reactivities | Human |
| Conjugation | HRP |
Anti-IFIT3 mouse monoclonal antibody, clone OTI1G1 (formerly 1G1)
| Applications | FC, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- IFIT3