Antibodies

Jump to Filters
View as table Download
IFT122 Rabbit Polyclonal Antibody
TA335415

USD 375.00

5 Days

Rabbit Polyclonal Anti-IFT122 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-IFT122 Antibody: synthetic peptide directed towards the C terminal of human IFT122. Synthetic peptide located within the following region: QADPAQKDTMLGKFYHFQRLAELYHGYHAIHRHTEDPFSVHRPETLFNIS
IFT122 Rabbit Polyclonal Antibody
TA357151

USD 360.00

5 Days

IFT122 Antibody - middle region

Applications WB
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human IFT122