Antibodies

Jump to Filters
View as table Download
IL17RD (N-term) Rabbit Polyclonal Antibody
AP52189PU-N

USD 450.00

2 Weeks

IL17RD (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 224~253 amino acids from the N-terminal region of human IL17RD
IL17RD Rabbit Polyclonal Antibody
TA308111

USD 415.00

5 Days

Rabbit Polyclonal antibody to IL17 receptor D (interleukin 17 receptor D)

Applications WB
Reactivities Human, Mouse (Predicted: Bovine)
Immunogen Recombinant fragment corresponding to a region within amino acids 286 and 531 of IL17 receptor D (Uniprot ID#Q8NFM7)
IL17RD Rabbit Polyclonal Antibody
TA343177

USD 375.00

5 Days

Rabbit Polyclonal Anti-IL17RD Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IL17RD antibody is: synthetic peptide directed towards the C-terminal region of Human IL17RD. Synthetic peptide located within the following region: STKYRLMDNLPQLCSHLHSRDHGLQEPGQHTRQGSRRNYFRSKSGRSLYV
IL17RD Rabbit Polyclonal Antibody
TA322312

USD 345.00

4 Weeks

Anti-IL17RD Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 322-671 amino acids of Human Interleukin-17 receptor D
IL17RD Rabbit Polyclonal Antibody
TA377432

USD 220.00

3 Weeks

IL17RD Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 150-300 of human IL17RD (NP_060033.3).
Modifications Unmodified