IL17RD Rabbit Polyclonal Antibody

CAT#: TA343177

Rabbit Polyclonal Anti-IL17RD Antibody

Product Images

Host: Rabbit; Target Name: IL17RD; Sample Tissue: THP-1 whole cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-IL17RD antibody is: synthetic peptide directed towards the C-terminal region of Human IL17RD. Synthetic peptide located within the following region: STKYRLMDNLPQLCSHLHSRDHGLQEPGQHTRQGSRRNYFRSKSGRSLYV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 65 kDa
• Gene Name: interleukin 17 receptor D
• Database Link:
  NP_060033
  Entrez Gene 54756 Human
  UniProt ID Q8NFM7
• Background: This gene encodes a membrane protein belonging to the interleukin-17 receptor (IL-17R) protein family. The encoded protein is a component of the interleukin-17 receptor signaling complex, and the interaction between this protein and IL-17R does not require the interleukin (PMID: 19079364). The gene product also affects fibroblast growth factor signaling, inhibiting or stimulating growth through MAPK/ERK signaling.
• Synonyms: HH18; IL-17RD; IL17RLM; SEF
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 79%

Reference Data

• Protein Families: Druggable Genome