Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-IL18R1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IL18R1 antibody: synthetic peptide directed towards the N terminal of human IL18R1. Synthetic peptide located within the following region: PFYLKHCSCSLAHEIETTTKSWYKSSGSQEHVELNPRSSSRIALHDCVLE |
IL18R1 mouse monoclonal antibody, clone B-E43, Azide Free
| Applications | FN |
| Reactivities | Human |
IL18R1 mouse monoclonal antibody, clone B-E43, Purified
| Applications | FC |
| Reactivities | Human |
IL18R1 mouse monoclonal antibody, clone B-E43, PE
| Applications | FC |
| Reactivities | Human |
| Conjugation | PE |
Il18r1 (Extracell. Dom.) rat monoclonal antibody, clone 7G31, Purified
| Applications | WB |
| Reactivities | Mouse |
Rabbit polyclonal anti-IL18R antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human IL18R. |
Anti-IL18R1 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 351-541 amino acids of human interleukin 18 receptor 1 |
Anti-IL18R1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 351-541 amino acids of human interleukin 18 receptor 1 |
Active filters
Target Symbol
- IL18R1