Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-IL18RAP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IL18RAP antibody: synthetic peptide directed towards the N terminal of human IL18RAP. Synthetic peptide located within the following region: NRLSPKQVPEHLPFMGSNDLSDVQWYQQPSNGDPLEDIRKSYPHIIQDKC |
IL18R Beta (IL18RAP) mouse monoclonal antibody, clone B-B46, Azide Free
| Applications | FN |
| Reactivities | Human |
IL18R Beta (IL18RAP) (N-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human IL18RAP |
Rabbit Polyclonal IL-18 R beta/IL-1 R7/ACPL Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a region within amino acids 50-150 of human IL-18 Receptor accessory protein/IL-18 RA/AcPL was used immunogen. |
Anti-IL18RAP Rabbit Polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 378-599 amino acids of human interleukin 18 receptor accessory protein |
Anti-IL18RAP Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 378-599 amino acids of human interleukin 18 receptor accessory protein |
Active filters
Target Symbol
- IL18RAP