IL24 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human IL24 |
IL24 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human IL24 |
Rabbit polyclonal antibody to Interleukin-24 (interleukin 24)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 142 and 206 of IL24 (Uniprot ID#Q13007) |
Rabbit Polyclonal Interleukin-24 Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody was made against a protein fragment from the C Terminus Region |
IL24 mouse monoclonal antibody, clone B-C60, Azide Free
| Reactivities | Human |
IL24 mouse monoclonal antibody, clone B-C51, Azide Free
| Reactivities | Human |
Rabbit Polyclonal Anti-IL24 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-IL24 antibody is: synthetic peptide directed towards the C-terminal region of IL24. Synthetic peptide located within the following region: STLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQLDVEAALT |
Carrier-free (BSA/glycerol-free) IL24 mouse monoclonal antibody,clone OTI4D1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) IL24 mouse monoclonal antibody,clone OTI3C5
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) IL24 mouse monoclonal antibody,clone OTI4E1
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) IL24 mouse monoclonal antibody,clone OTI4H4
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) IL24 mouse monoclonal antibody,clone OTI5C8
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
IL24 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human IL24 |
IL24 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 52-140 of human IL24 (NP_001172085.1). |
| Modifications | Unmodified |
IL24 mouse monoclonal antibody,clone OTI4D1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
IL24 mouse monoclonal antibody,clone OTI4D1, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
IL24 mouse monoclonal antibody,clone OTI4D1, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
IL24 mouse monoclonal antibody,clone OTI4D1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
IL24 mouse monoclonal antibody,clone OTI3C5
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
IL24 mouse monoclonal antibody,clone OTI3C5, Biotinylated
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Biotin |
IL24 mouse monoclonal antibody,clone OTI3C5, HRP conjugated
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | HRP |
IL24 mouse monoclonal antibody,clone OTI3C5
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
IL24 mouse monoclonal antibody,clone OTI4E1
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
IL24 mouse monoclonal antibody,clone OTI4E1, Biotinylated
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Biotin |
IL24 mouse monoclonal antibody,clone OTI4E1, HRP conjugated
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | HRP |
IL24 mouse monoclonal antibody,clone OTI4E1
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
IL24 mouse monoclonal antibody,clone OTI4H4
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
IL24 mouse monoclonal antibody,clone OTI4H4, Biotinylated
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Biotin |
IL24 mouse monoclonal antibody,clone OTI4H4, HRP conjugated
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | HRP |
IL24 mouse monoclonal antibody,clone OTI4H4
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
IL24 mouse monoclonal antibody,clone OTI5C8
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
IL24 mouse monoclonal antibody,clone OTI5C8, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
IL24 mouse monoclonal antibody,clone OTI5C8, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
IL24 mouse monoclonal antibody,clone OTI5C8
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |