Rabbit Polyclonal Anti-IMPDH1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-IMPDH1 Antibody: synthetic peptide directed towards the middle region of human IMPDH1. Synthetic peptide located within the following region: KKGKLPIVNDCDELVAIIARTDLKKNRDYPLASKDSQKQLLCGAAVGTRE |
Rabbit Polyclonal Anti-IMPDH1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-IMPDH1 Antibody is: synthetic peptide directed towards the C-terminal region of IMPDH1. Synthetic peptide located within the following region: DGVRLKKYRGMGSLDAMEKSSSSQKRYFSEGDKVKIAQGVSGSIQDKGSI |
IMPDH1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 434-563 of human IMPDH1 (NP_899066.1). |
IMPDH1 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 434-563 of human IMPDH1 (NP_899066.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
