Rabbit anti-ING3 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ING3 |
Rabbit anti-ING3 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ING3 |
Goat polyclonal anti-p47 ING3 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was prepared from whole Goat serum produced by repeated immunizations with a synthetic peptide corresponding aa 294-304 of Human ING3 protein (Inhibitor of growth family, member 3). This sequence only shows homology to isoform 1 for ING3. |
Rabbit Polyclonal Anti-ING3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ING3 Antibody: synthetic peptide directed towards the N terminal of human ING3. Synthetic peptide located within the following region: MDQLEQRVSEFFMNAKKNKPEWREEQMASIKKDYYKALEDADEKVQLANQ |
Rabbit Polyclonal Anti-ING3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ING3 Antibody: synthetic peptide directed towards the middle region of human ING3. Synthetic peptide located within the following region: LSSGTGAGAITMAAAQAVQATAQMKEGRRTSSLKASYEAFKNNDFQLGKE |