Antibodies

Jump to Filters
View as table Download
INSL5 Rabbit Polyclonal Antibody
TA340061

USD 375.00

5 Days

Rabbit Polyclonal Anti-INSL5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-INSL5 antibody: synthetic peptide directed towards the middle region of human INSL5. Synthetic peptide located within the following region: RTVIYICASSRWRRHQEGIPQAQQAETGNSFQLPHKREFSEENPAQNLPK
INSL5 Rabbit Polyclonal Antibody
TA359156

USD 360.00

5 Days

INSL5 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human INSL5