INSL5 Rabbit Polyclonal Antibody

CAT#: TA340061

Rabbit Polyclonal Anti-INSL5 Antibody

Product Images

WB Suggested Anti-INSL5 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Hela cell lysate

• 

  Host: Rabbit; Target Name: INSL5; Sample Tissue: Fetal Lung lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-INSL5 antibody: synthetic peptide directed towards the middle region of human INSL5. Synthetic peptide located within the following region: RTVIYICASSRWRRHQEGIPQAQQAETGNSFQLPHKREFSEENPAQNLPK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 13 kDa
• Gene Name: insulin like 5
• Database Link:
  NP_005469
  Entrez Gene 10022 Human
  UniProt ID Q9Y5Q6
• Background: The protein encoded by this gene contains a classical signature of the insulin superfamily and is highly similar to relaxin 3 (RLN3/INSL7).
• Synonyms: PRO182; UNQ156
• Note: Immunogen Sequence Homology: Human: 100%; Rabbit: 79%

Reference Data

• Protein Families: Secreted Protein