Antibodies

View as table Download

INTS1 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the N-terminal region of Human INTS1

Rabbit Polyclonal Anti-INTS1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-INTS1 Antibody is: synthetic peptide directed towards the N-terminal region of Human INTS1. Synthetic peptide located within the following region: TVRRPSAAAKPSGHPPPGDFIALGSKGQANESKTASTLLKPAPSGLPSER

Rabbit Polyclonal Anti-INTS1 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human INTS1