Antibodies

View as table Download

IST1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human IST1

Rabbit Polyclonal Anti-IST1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-IST1 Antibody is: synthetic peptide directed towards the N-terminal region of Human IST1. Synthetic peptide located within the following region: INRLKLLEKKKTELAQKARKEIADYLAAGKDERARIRVEHIIREDYLVEA

Rabbit Polyclonal Anti-IST1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-IST1 Antibody is: synthetic peptide directed towards the C-terminal region of Human IST1. Synthetic peptide located within the following region: TDLIDVGFTDDVKKGGPGRGGSGGFTAPVGGPDGTVPMPMPMPMPSANTP

IST1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human IST1

IST1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-335 of human IST1 (NP_001257906.1).
Modifications Unmodified