Antibodies

Jump to Filters
View as table Download
Junctional Adhesion Molecule 2 (JAM2) Rabbit Polyclonal Antibody
TA308335

USD 415.00

In Stock

Rabbit Polyclonal antibody to JAM-B (junctional adhesion molecule 2)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 294 of JAM-B (Uniprot ID#P57087)
Junctional Adhesion Molecule 2 (JAM2) Goat Polyclonal Antibody
TA305924

USD 375.00

5 Days

Goat Anti-JAM2 / JAMB / CD322 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QRKGYFSKETSFQ, from the internal region of the protein sequence according to NP_067042.1.
Junctional Adhesion Molecule 2 (JAM2) Rabbit Polyclonal Antibody
TA338012

USD 375.00

5 Days

Rabbit Polyclonal Anti-JAM2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-JAM2 antibody is: synthetic peptide directed towards the middle region of Human JAM2. Synthetic peptide located within the following region: LVAPAVPSCEVPSSALSGTVVELRCQDKEGNPAPEYTWFKDGIRLLENPR
Junctional Adhesion Molecule 2 (JAM2) Rabbit Polyclonal Antibody
TA377654

USD 220.00

3 Weeks

JAM2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 29-238 of human JAM2 (NP_067042.1).
Modifications Unmodified
Junctional Adhesion Molecule 2 (JAM2) Rabbit Polyclonal Antibody
TA377655

USD 220.00

3 Weeks

JAM2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 29-238 of human JAM2 (NP_067042.1).
Modifications Unmodified