Antibodies

View as table Download

Rabbit Polyclonal antibody to JAM-B (junctional adhesion molecule 2)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 294 of JAM-B (Uniprot ID#P57087)

Goat Anti-JAM2 / JAMB / CD322 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QRKGYFSKETSFQ, from the internal region of the protein sequence according to NP_067042.1.

Rabbit Polyclonal Anti-JAM2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-JAM2 antibody is: synthetic peptide directed towards the middle region of Human JAM2. Synthetic peptide located within the following region: LVAPAVPSCEVPSSALSGTVVELRCQDKEGNPAPEYTWFKDGIRLLENPR

JAM2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 29-238 of human JAM2 (NP_067042.1).
Modifications Unmodified

JAM2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 29-238 of human JAM2 (NP_067042.1).
Modifications Unmodified