Antibodies

Jump to Filters
View as table Download
Jaml Hamster Monoclonal Antibody [Clone ID: eBio4E10 (4E10)]
TA320220

USD 195.00

5 Days

Hamster Anti-Mouse JAML Purified (50 ug)

Applications FC
Reactivities Mouse
Conjugation Unconjugated
JAML Rabbit Polyclonal Antibody
TA334401

USD 375.00

5 Days

Rabbit Polyclonal Anti-AMICA1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AMICA1 antibody is: synthetic peptide directed towards the C-terminal region of Human AMICA1. Synthetic peptide located within the following region: VCATILLLPVLILIVKKTCGNKSSVNSTVLVKNTKKTNPEMKEKPCHFER