Antibodies

View as table Download

Hamster Anti-Mouse JAML Purified (50 ug)

Applications FC
Reactivities Mouse
Conjugation Unconjugated

Rabbit Polyclonal Anti-AMICA1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AMICA1 antibody is: synthetic peptide directed towards the C-terminal region of Human AMICA1. Synthetic peptide located within the following region: VCATILLLPVLILIVKKTCGNKSSVNSTVLVKNTKKTNPEMKEKPCHFER