Antibodies

Jump to Filters
View as table Download
Lysyl tRNA synthetase (KARS) Rabbit Polyclonal Antibody
TA345923

USD 475.00

5 Days

Rabbit Polyclonal Anti-KARS Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KARS antibody: synthetic peptide directed towards the C terminal of human KARS. Synthetic peptide located within the following region: GMGIDRVAMFLTDSNNIKEVLLFPAMKPEDKKENVATTDTLESTTVGTSV
KARS1 Rabbit Polyclonal Antibody
TA369181

USD 380.00

4 Weeks

KARS1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human KARS1