Lysyl tRNA synthetase (KARS) Rabbit Polyclonal Antibody

CAT#: TA345923

Rabbit Polyclonal Anti-KARS Antibody

Product Images

WB Suggested Anti-KARS Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: HepG2 cell lysate; KARS is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells

• 

  Rabbit Anti-KARS Antibody; Paraffin Embedded Tissue: Human Intestine; Cellular Data: Epithelial cells of intestinal villas; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KARS antibody: synthetic peptide directed towards the C terminal of human KARS. Synthetic peptide located within the following region: GMGIDRVAMFLTDSNNIKEVLLFPAMKPEDKKENVATTDTLESTTVGTSV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 66 kDa
• Gene Name: lysyl-tRNA synthetase
• Database Link:
  NP_005539
  Entrez Gene 3735 Human
  UniProt ID Q15046
• Background: Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. Lysyl-tRNA synthetase is a homodimer localized to the cytoplasm which belongs to the class II family of tRNA synthetases. It has been shown to be a target of autoantibodies in the human autoimmune diseases, polymyositis or dermatomyositis Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. Lysyl-tRNA synthetase is a homodimer localized to the cytoplasm which belongs to the class II family of tRNA synthetases. It has been shown to be a target of autoantibodies in the human autoimmune diseases, polymyositis or dermatomyositis.
• Synonyms: CMTRIB; DFNB89; KARS1; KARS2; KRS
• Note: Immunogen Sequence Homology: Human: 100%; Bovine: 92%; Horse: 88%; Pig: 86%; Rat: 86%; Rabbit: 86%; Guinea pig: 85%; Mouse: 79%

Reference Data

• Protein Pathways: Aminoacyl-tRNA biosynthesis