Antibodies

Jump to Filters
View as table Download
KCNK13 Rabbit Polyclonal Antibody
TA319967

USD 430.00

2 Weeks

Rabbit Polyclonal KCNK13 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen KCNK13 antibody was raised against a 15 amino acid synthetic peptide near the center of human KCNK13.
KCNK13 Rabbit Polyclonal Antibody
TA338706

USD 375.00

5 Days

Rabbit Polyclonal Anti-KCNK13 Antibody

Applications IHC, WB
Reactivities Human, Dog
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNK13 antibody: synthetic peptide directed towards the C terminal of human KCNK13. Synthetic peptide located within the following region: GEMISMKDLLAANKASLAILQKQLSEMANGCPHQTSTLARDNEFSGGVGA
Kcnk13 Rabbit Polyclonal Antibody
TA328974

USD 585.00

3 Weeks

Rabbit polyclonal Anti-K2P13.1 (THIK-1) (extracellular)

Applications IHC, WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)EERLANFSRGHNLSRE, corresponding to amino acid residues 54-69 of rat K2P13.1. 1st extracellular loop..
KCNK13 Rabbit Polyclonal Antibody
TA338707

USD 310.00

5 Days

Rabbit Polyclonal Anti-KCNK13 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNK13 antibody: synthetic peptide directed towards the C terminal of human KCNK13. Synthetic peptide located within the following region: SMKDLLAANKASLAILQKQLSEMANGCPHQTSTLARDNEFSGGVGAFAIM
KCNK13 Rabbit Polyclonal Antibody
TA350112

USD 345.00

In Stock

Rabbit Polyclonal Anti-KCNK13 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human KCNK13