Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-KCNS1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNS1 antibody: synthetic peptide directed towards the N terminal of human KCNS1. Synthetic peptide located within the following region: LCDDYDEAAREFYFDRHPGFFLSLLHFYRTGHLHVLDELCVFAFGQEADY |
Rabbit polyclonal Anti-KV9.1 (extracellular)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide (C)EDVRDDPVLRRLE, corresponding to amino acid residues 233-245 of rat KV9.1 . 1st extracellular loop. |
Rabbit Polyclonal Anti-KCNS1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNS1 antibody: synthetic peptide directed towards the N terminal of human KCNS1. Synthetic peptide located within the following region: LMLLVRGTHYENLRSKVVLPTPLGGRSTETFVSEFPGPDTGIRWRRSDEA |
Active filters
Target Symbol
- KCNS1