Antibodies

View as table Download

Rabbit Polyclonal Anti-KCTD16 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCTD16 antibody: synthetic peptide directed towards the N terminal of human KCTD16. Synthetic peptide located within the following region: KREAEYFQLPDLVKLLTPDEIKQSPDEFCHSDFEDASQGSDTRICPPSSL

Rabbit Polyclonal Anti-KCTD16 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCTD16 antibody: synthetic peptide directed towards the N terminal of human KCTD16. Synthetic peptide located within the following region: KREAEYFQLPDLVKLLTPDEIKQSPDEFCHSDFEDASQGSDTRICPPSSL

KCTD16 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human KCTD16

KCTD16 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human KCTD16