Germany
Japan
United Kingdom
China
KCTD16 Rabbit Polyclonal Antibody
Product Images
Frequently bought together (3)
Recombinant protein of human potassium channel tetramerisation domain containing 16 (KCTD16)
USD 823.00
Transient overexpression lysate of potassium channel tetramerisation domain containing 16 (KCTD16)
USD 396.00
Other products for "KCTD16"
Specifications
| Product Data | |
| Applications | WB |
| Recommended Dilution | WB |
| Reactivities | Human |
| Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-KCTD16 antibody: synthetic peptide directed towards the N terminal of human KCTD16. Synthetic peptide located within the following region: KREAEYFQLPDLVKLLTPDEIKQSPDEFCHSDFEDASQGSDTRICPPSSL |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 49 kDa |
| Gene Name | potassium channel tetramerization domain containing 16 |
| Database Link | |
| Background | The function of this protein remains unknown. |
| Synonyms | DKFZp781A1155; KIAA1317; MGC138167 |
| Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 79% |
| Reference Data | |
Documents
| Product Manuals |
| FAQs |
| SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.