Rabbit Polyclonal Anti-KIF1C Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KIF1C antibody: synthetic peptide directed towards the C terminal of human KIF1C. Synthetic peptide located within the following region: GGGRSRGAGSAQPEPQHFQPKKHNSYPQPPQPYPAQRPPGPRYPPYTTPP |
KIF1C Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human KIF1C |
KIF1C Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 810-960 of human KIF1C (NP_006603.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
