KIF1C Rabbit Polyclonal Antibody

CAT#: TA334693

Rabbit Polyclonal Anti-KIF1C Antibody

Product Images

WB Suggested Anti-KIF1C Antibody Titration: 2.5 ug/ml; Positive Control: Hela cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KIF1C antibody: synthetic peptide directed towards the C terminal of human KIF1C. Synthetic peptide located within the following region: GGGRSRGAGSAQPEPQHFQPKKHNSYPQPPQPYPAQRPPGPRYPPYTTPP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 123 kDa
• Gene Name: kinesin family member 1C
• Database Link:
  NP_006603
  Entrez Gene 10749 Human
  UniProt ID O43896
• Background: KIF1C represents a member of the Unc104 subfamily of kinesin-like proteins that are involved in the transport of mitochondria or synaptic vesicles in axons. KIF1C consists of an amino-terminal motor domain followed by a U104 domain and probably binds to target membranes through carboxyl-terminal sequences.
• Synonyms: LTXS1; SATX2; SAX2; SPAX2; SPG58
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Horse: 92%; Rat: 85%; Mouse: 77%; Guinea pig: 77%

Reference Data

• Protein Families: Druggable Genome