Antibodies

Jump to Filters
View as table Download
KIF5B Goat Polyclonal Antibody
TA302804

USD 375.00

2 Weeks

Goat Polyclonal Antibody against KIF5B

Applications IHC, WB
Reactivities Human, Dog
Conjugation Unconjugated
Immunogen Peptide with sequence C-QPVAVRGGGGKQV, from the C Terminus of the protein sequence according to NP_004512.1.
KIF5B Rabbit Polyclonal Antibody
TA308913

USD 415.00

5 Days

Rabbit Polyclonal antibody to UKHC (kinesin family member 5B)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 901 and 963 of UKHC (Uniprot ID#P33176)
KIF5B Rabbit Polyclonal Antibody
TA334689

USD 375.00

5 Days

Rabbit Polyclonal Anti-KIF5B Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KIF5B antibody: synthetic peptide directed towards the N terminal of human KIF5B. Synthetic peptide located within the following region: CNIKVMCRFRPLNESEVNRGDKYIAKFQGEDTVVIASKPYAFDRVFQSST
KIF5B Rabbit Polyclonal Antibody
TA334690

USD 375.00

5 Days

Rabbit Polyclonal Anti-KIF5B Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-KIF5B antibody: synthetic peptide directed towards the C terminal of human KIF5B. Synthetic peptide located within the following region: ANEVKQAVEQQIQSHRETHQKQISSLRDEVEAKAKLITDLQDQNQKMMLE
KIF5B Rabbit Polyclonal Antibody
TA377808

USD 220.00

3 Weeks

KIF5B Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 650-770 of human KIF5B (NP_004512.1).
Modifications Unmodified