KIF5B Rabbit Polyclonal Antibody

CAT#: TA334689

Rabbit Polyclonal Anti-KIF5B Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "KIF5B"

Specifications

Product Data
Applications IHC, WB
Recommended Dilution WB, IHC
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-KIF5B antibody: synthetic peptide directed towards the N terminal of human KIF5B. Synthetic peptide located within the following region: CNIKVMCRFRPLNESEVNRGDKYIAKFQGEDTVVIASKPYAFDRVFQSST
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 110 kDa
Gene Name kinesin family member 5B
Background Kinesin is the founding member of a superfamily of microtubule based motor proteins that perform force-generating tasks such as organelle transport and chromosome segregation. Kinesin consists of heavy and light chains both of which have been documented to bind a variety of potential linker or cargo proteins. KIF5B is an isoform of kinesin heavy chain.
Synonyms HEL-S-61; KINH; KNS; KNS1; UKHC
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Human: 100%; Bovine: 100%; Rat: 93%; Mouse: 93%; Zebrafish: 86%
Reference Data
Protein Families Druggable Genome

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.