Rabbit Polyclonal Anti-KIF7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KIF7 antibody is: synthetic peptide directed towards the C-terminal region of Human KIF7. Synthetic peptide located within the following region: RDLVHAPLPLTWKRSSLCGEEQGSPEELRQREAAEPLVGRVLPVGEAGLP |
KIF7 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
KIF7 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1044-1343 of human KIF7 (NP_940927.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
