Rabbit Polyclonal Anti-KLHL26 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KLHL26 antibody: synthetic peptide directed towards the C terminal of human KLHL26. Synthetic peptide located within the following region: EAGCCLLERKIYIVGGYNWRLNNVTGIVQVYNTDTDEWERDLHFPESFAG |
Rabbit Polyclonal Anti-KLHL26 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KLHL26 antibody: synthetic peptide directed towards the N terminal of human KLHL26. Synthetic peptide located within the following region: AESGGSSGGAGGGGAFGAGPGPERPNSTADKNGALKCTFSAPSHSTSLLQ |
Rabbit Polyclonal Anti-KLHL26 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KLHL26 antibody: synthetic peptide directed towards the middle region of human KLHL26. Synthetic peptide located within the following region: QVLPFRQHEMQSPRTAVRSDVPSLVTFGGTPYTDSDRSVSSKVYQLPEPG |
Rabbit Polyclonal Anti-Klhl26 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Klhl26 antibody is synthetic peptide directed towards the N-terminal region of Mouse Klhl26. Synthetic peptide located within the following region: GQLLDVVLTVNSEAFHAHKVVLAACSDYFRAMFTGGMREANQAVIQLQGV |
Germany
Japan
United Kingdom
China
