KLHL26 Rabbit Polyclonal Antibody

CAT#: TA337230

Rabbit Polyclonal Anti-Klhl26 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "KLHL26"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Mouse
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-Klhl26 antibody is synthetic peptide directed towards the N-terminal region of Mouse Klhl26. Synthetic peptide located within the following region: GQLLDVVLTVNSEAFHAHKVVLAACSDYFRAMFTGGMREANQAVIQLQGV
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 67 kDa
Gene Name kelch like family member 26
Background The function of this protein remains unknown.
Synonyms FLJ11078
Note Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%; Mouse: 86%; Bovine: 86%; Rabbit: 86%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.