Germany
Japan
United Kingdom
China
KBTBD10 (KLHL41) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 546-575 amino acids from the C-terminal region of human KBTBD10 |
Antibodies
View as table Download
Rabbit Polyclonal Anti-KBTBD10 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KBTBD10 antibody: synthetic peptide directed towards the N terminal of human KBTBD10. Synthetic peptide located within the following region: MDSQRELAEELRLYQSTLLQDGLKDLLDEKKFIDCTLKAGDKSLPCHRLI |
Rabbit Polyclonal Anti-KBTBD10 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KBTBD10 antibody: synthetic peptide directed towards the C terminal of human KBTBD10. Synthetic peptide located within the following region: AGSLYAIGGFAMIQLESKEFAPTEVNDIWKYEDDKKEWAGMLKEIRYASG |
KLHL41 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of HUMAN KLHL41 |
KLHL41 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human KLHL41 (NP_006054.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- KLHL41