KBTBD10 (KLHL41) Rabbit Polyclonal Antibody

CAT#: TA343579

Rabbit Polyclonal Anti-KBTBD10 Antibody

Product Images

WB Suggested Anti-KBTBD10 Antibody Titration: 1.25 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Human Muscle

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KBTBD10 antibody: synthetic peptide directed towards the C terminal of human KBTBD10. Synthetic peptide located within the following region: AGSLYAIGGFAMIQLESKEFAPTEVNDIWKYEDDKKEWAGMLKEIRYASG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 68 kDa
• Gene Name: kelch like family member 41
• Database Link:
  NP_006054
  Entrez Gene 10324 Human
  UniProt ID O60662
• Background: KBTBD10 contains 1 BTB (POZ) domain and is required for pseudopod elongation in transformed cells. KBTBD10 mRNA is up-regulated by less than two folds in the heart in human patients with HCM.
• Synonyms: KBTBD10; Krp1; SARCOSIN
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%