Cytokeratin 3 (KRT3) guinea pig polyclonal antibody, Serum
Applications | IF, IHC |
Reactivities | Human, Mouse |
Immunogen | Synthetic peptide of Human keratin K3 (formerly also designated cytokeratin 3; C- IKF SQS SQS SQR YSR), coupled to KLH |
Cytokeratin 3 (KRT3) guinea pig polyclonal antibody, Serum
Applications | IF, IHC |
Reactivities | Human, Mouse |
Immunogen | Synthetic peptide of Human keratin K3 (formerly also designated cytokeratin 3; C- IKF SQS SQS SQR YSR), coupled to KLH |
Cytokeratin 3 (KRT3) mouse monoclonal antibody, clone AE5, Purified
Applications | IHC, WB |
Reactivities | Bovine, Human, Rabbit |
Cytokeratin 3 (KRT3) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 413-441 amino acids from the Central region of human KRT3 |
Rabbit Polyclonal Anti-KRT3 Antibody
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KRT3 antibody: synthetic peptide directed towards the C terminal of human KRT3. Synthetic peptide located within the following region: GSSGFSGGSGFGSISGARYGVSGGGFSSASNRGGSIKFSQSSQSSQRYSR |
KRT3 Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 230-390 of human KRT3 (NP_476429.2). |
Modifications | Unmodified |