Antibodies

View as table Download

Cytokeratin 3 (KRT3) guinea pig polyclonal antibody, Serum

Applications IF, IHC
Reactivities Human, Mouse
Immunogen Synthetic peptide of Human keratin K3 (formerly also designated cytokeratin 3; C- IKF SQS SQS SQR YSR), coupled to KLH

Cytokeratin 3 (KRT3) mouse monoclonal antibody, clone AE5, Purified

Applications IHC, WB
Reactivities Bovine, Human, Rabbit

Cytokeratin 3 (KRT3) (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 413-441 amino acids from the Central region of human KRT3

Rabbit Polyclonal Anti-KRT3 Antibody

Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KRT3 antibody: synthetic peptide directed towards the C terminal of human KRT3. Synthetic peptide located within the following region: GSSGFSGGSGFGSISGARYGVSGGGFSSASNRGGSIKFSQSSQSSQRYSR

KRT3 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 230-390 of human KRT3 (NP_476429.2).
Modifications Unmodified