Germany
Japan
United Kingdom
China
Antibodies
View as table Download
KCNA3 rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
Mouse monoclonal Kv1.3 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
KCNA3 (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 238-268 amino acids from the Central region of human KCNA3 |
Rabbit Polyclonal Anti-KV1.3
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | GST fusion protein with sequence TLSKSEYMVIEEGGMNHSAFPQTPFKTGNSTATCTTNNNPNSCVNIKKIFTDV, corresponding to amino acid residues 523-575 of human Kv1.3. Intracellular, C-terminus. |
Rabbit Polyclonal Anti-KCNA3 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | KCNA3 / Kv1.3 antibody was raised against synthetic 17 amino acid peptide from internal region of human KCNA3 / Kv1.3. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey, Mouse, Rat (88%). |
Rabbit Polyclonal Anti-KCNA3 Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | KCNA3 / Kv1.3 antibody was raised against synthetic 16 amino acid peptide from C-terminus of human KCNA3 / Kv1.3. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Rabbit, Pig (100%); Bovine, Opossum (94%); Lizard (88%); Turkey, Chicken (81%). |
Active filters
Target Symbol
- KCNA3