Antibodies

View as table Download

Rabbit polyclonal Anti-Kir2.2

Applications WB
Reactivities Rat
Immunogen Peptide (C)EVATDRDGRSPQPEHDFDRÂ corresponding to amino acid residues 391-409 of rat Kir2.2 . Intracellular, C-terminal part.

Rabbit Polyclonal Anti-KCNJ12 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNJ12 antibody: synthetic peptide directed towards the middle region of human KCNJ12. Synthetic peptide located within the following region: KDLVENKFLLPSANSFCYENELAFLSRDEEDEADGDQDGRSRDGLSPQAR

KCNJ12 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 354-433 of human KCNJ12 (NP_066292.2).
Modifications Unmodified