Germany
Japan
United Kingdom
China
Rabbit polyclonal Anti-Kir3.4 (GIRK4)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide RNAMNQDMEIGVT(C), corresponding to amino acid residues 6-18 of rat Kir3.4 .? ? Intracellular, N-terminus. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-KCNJ5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNJ5 antibody: synthetic peptide directed towards the N terminal of human KCNJ5. Synthetic peptide located within the following region: AGDSRNAMNQDMEIGVTPWDPKKIPKQARDYVPIATDRTRLLAEGKKPRQ |
KCNJ5 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human KCNJ5 |
KCNJ5 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human KCNJ5 (NP_000881.3). |
| Modifications | Unmodified |
Active filters
Target Symbol
- KCNJ5