Antibodies

Jump to Filters
View as table Download
KCNK4 Rabbit Polyclonal Antibody
TA328664

USD 585.00

3 Weeks

Rabbit Polyclonal Anti-K2P4.1 (TRAAK)

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Peptide NLAFIDESSDTQSERGC, corresponding to amino acid residues 343-359 of human K2P4.1 . Intracellular, C-terminus.
KCNK4 Rabbit Polyclonal Antibody
TA338723

USD 375.00

5 Days

Rabbit Polyclonal Anti-KCNK4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNK4 antibody: synthetic peptide directed towards the N terminal of human KCNK4. Synthetic peptide located within the following region: MRSTTLLALLALVLLYLVSGALVFRALEQPHEQQAQRELGEVREKFLRAH
KCNK4 Rabbit Polyclonal Antibody
TA342055

USD 375.00

5 Days

Rabbit Polyclonal Anti-KCNK4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNK4 antibody: synthetic peptide directed towards the N terminal of human KCNK4. Synthetic peptide located within the following region: ELGEVREKFLRAHPCVSDQELGLLIKEVADALGGGADPETNSTSNSSHSA
KCNK4 Rabbit Polyclonal Antibody
TA355758

USD 360.00

5 Days

KCNK4 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human KCNK4
KCNK4 Rabbit Polyclonal Antibody
TA377731

USD 220.00

3 Weeks

KCNK4 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 25-90 of human KCNK4 (NP_201567.1).
Modifications Unmodified