Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat Anti-KCNQ4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DKGPSDAEVVDE, from the internal region of the protein sequence according to NP_004691.2; NP_751895.1. |
Rabbit polyclonal anti-KCNQ4 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human KCNQ4. |
Rabbit Polyclonal Anti-KCNQ4 Antibody
| Applications | WB |
| Reactivities | Hamster, Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNQ4 antibody: synthetic peptide directed towards the middle region of human KCNQ4. Synthetic peptide located within the following region: SSRMGIKDRIRMGSSQRRTGPSKQHLAPPTMPTSPSSEQVGEATSPTKVQ |
KCNQ4 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human KCNQ4 |
Active filters
Target Symbol
- KCNQ4