Antibodies

Jump to Filters
View as table Download
KCTD18 Rabbit Polyclonal Antibody
TA338737

USD 310.00

5 Days

Rabbit Polyclonal Anti-KCTD18 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCTD18 antibody: synthetic peptide directed towards the N terminal of human KCTD18. Synthetic peptide located within the following region: LHYLNTSGASCESRIIGVYATKTDGTDAIEKQLGGRIHSKGIFKREAGNN
KCTD18 Rabbit Polyclonal Antibody
TA366611

USD 380.00

4 Weeks

KCTD18 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human KCTD18
KCTD18 Rabbit Polyclonal Antibody
TA370962

USD 380.00

4 Weeks

KCTD18 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human KCTD18