KCTD18 Rabbit Polyclonal Antibody

CAT#: TA338737

Rabbit Polyclonal Anti-KCTD18 Antibody

Product Images

WB Suggested Anti-KCTD18 Antibody Titration: 5.0 ug/ml; ELISA Titer: 1:312500; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KCTD18 antibody: synthetic peptide directed towards the N terminal of human KCTD18. Synthetic peptide located within the following region: LHYLNTSGASCESRIIGVYATKTDGTDAIEKQLGGRIHSKGIFKREAGNN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 47 kDa
• Gene Name: potassium channel tetramerization domain containing 18
• Database Link:
  NP_689600
  Entrez Gene 130535 Human
  UniProt ID Q6PI47
• Background: The function of Anti-KCTD18 has not yet been determined.
• Synonyms: 6530404F10Rik
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 86%

Reference Data

• Protein Families: Ion Channels: Other