Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-KIF2A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KIF2A antibody: synthetic peptide directed towards the middle region of human KIF2A. Synthetic peptide located within the following region: DSYATQLEAILEQKIDILTELRDKVKSFRAALQEEEQASKQINPKRPRAL |
Rabbit Polyclonal Anti-KIF2A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KIF2A antibody: synthetic peptide directed towards the N terminal of human KIF2A. Synthetic peptide located within the following region: IEPSPETPPPPASSAKVNKIVKNRRTVASIKNDPPSRDNRVVGSARARPS |
Rabbit Polyclonal Anti-KIF2A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KIF2A antibody: synthetic peptide directed towards the C terminal of human KIF2A. Synthetic peptide located within the following region: ETQWGVGSSPQRDDLKLLCEQNEEEVSPQLFTFHEAVSQMVEMEEQVVED |
Rabbit Polyclonal Anti-KIF2A Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human KIF2A |
KIF2A rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human KIF2A |
KIF2A rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human KIF2A |
KIF2A Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 30-220 of human KIF2A (NP_004511.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- KIF2A