Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal KIF5 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | KIF5 antibody was raised against a 20 amino acid synthetic peptide from near the carboxy terminus of human KIF5. The immunogen is located within amino acids 880 - 930 of KIF5. |
Rabbit Polyclonal Anti-KIF5A Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KIF5A antibody: synthetic peptide directed towards the middle region of human KIF5A. Synthetic peptide located within the following region: LEESYDSLSDELAKLQAQETVHEVALKDKEPDTQDADEVKKALELQMESH |
KIF5A rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human KIF5A |
KIF5A Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 933-1032 of human KIF5A (NP_004975.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- KIF5A