Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal antibody to KPNA4 (karyopherin alpha 4 (importin alpha 3))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 459 and 521 of KPNA4 (Uniprot ID#O00629) |
Goat Polyclonal Antibody against KPNA4 / IPOA3
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-NSSANVPTEGFQF, from the C Terminus of the protein sequence according to NP_002259.1. |
Rabbit Polyclonal Anti-KPNA4 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KPNA4 antibody: synthetic peptide directed towards the N terminal of human KPNA4. Synthetic peptide located within the following region: KNKRDEHLLKRRNVPHEDICEDSDIDGDYRVQNTSLEAIVQNASSDNQGI |
Active filters
Target Symbol
- KPNA4