Germany
Japan
United Kingdom
China
Cytokeratin 10 (KRT10) guinea pig polyclonal antibody, Serum
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide of Human Keratin K10 (formerly also designated Cytokeratin 10; C-GS VGE SSS KGP RY), coupled to KLH |
Antibodies
View as table Download
Rabbit Polyclonal Anti-KRT10 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KRT10 antibody: synthetic peptide directed towards the N terminal of human KRT10. Synthetic peptide located within the following region: EKVTMQNLNDRLASYLDKVRALEESNYELEGKIKEWYEKHGNSHQGEPRD |
Rabbit Polyclonal Anti-Keratin 10 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Keratin 10 Antibody: A synthesized peptide derived from human Keratin 10 |
Anti-KRT10 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 570-584 amino acids of human keratin 10 |
USD 400.00
2 Weeks
Cytokeratin 10 (KRT10) (+KRT13) mouse monoclonal antibody, clone CK208, Purified
| Applications | IF, IHC |
| Reactivities | Human |
USD 280.00
2 Weeks
Cytokeratin 10 (KRT10) (+KRT13) mouse monoclonal antibody, clone CK208, Purified
| Applications | IF, IHC |
| Reactivities | Human |
Cytokeratin 10 (KRT10) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the Center region of human KRT10 |
Cytokeratin 10 (KRT10) (N-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human KRT10 |
Mouse monoclonal Anti-Keratin10 Clone LH2
| Reactivities | Human |
| Conjugation | Unconjugated |
Anti-KRT10 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 570-584 amino acids of human keratin 10 |
KRT10 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human KRT10 |
| Modifications | Unmodified |
Cytokeratin 10 Mouse monoclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthesized peptide derived from human Cytokeratin 10 |
Active filters
Target Symbol
- KRT10