Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-KRT9 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KRT9 antibody is: synthetic peptide directed towards the N-terminal region of Human KRT9. Synthetic peptide located within the following region: VAPGKDLTKTLNDMRQEYEQLIAKNRKDIENQYETQITQIEHEVSSSGQE |
Rabbit Polyclonal Anti-KRT9 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KRT9 antibody is: synthetic peptide directed towards the C-terminal region of Human KRT9. Synthetic peptide located within the following region: EIELQSQLSKKAALEKSLEDTKNRYCGQLQMIQEQISNLEAQITDVRQEI |
KRT9 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human KRT9 |
Cytokeratin 9 (KRT9) Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 150-450 of human Cytokeratin 9 (KRT9) (KRT9) (NP_000217.2). |
| Modifications | Unmodified |
Cytokeratin 9 Rabbit polyclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human Cytokeratin 9 |
Active filters
Target Symbol
- KRT9