Cytokeratin 9 (KRT9) Rabbit Polyclonal Antibody

CAT#: TA338384

Rabbit Polyclonal Anti-KRT9 Antibody

Product Images

WB Suggested Anti-KRT9 Antibody; Titration: 1.0 ug/ml; Positive Control: Fetal Heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KRT9 antibody is: synthetic peptide directed towards the C-terminal region of Human KRT9. Synthetic peptide located within the following region: EIELQSQLSKKAALEKSLEDTKNRYCGQLQMIQEQISNLEAQITDVRQEI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 62 kDa
• Gene Name: keratin 9
• Database Link:
  NP_000217
  Entrez Gene 3857 Human
  UniProt ID P35527
• Background: This gene encodes the type I keratin 9, an intermediate filament chain expressed only in the terminally differentiated epidermis of palms and soles. Mutations in this gene cause epidermolytic palmoplantar keratoderma.
• Synonyms: CK-9; EPPK; K9
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Rat: 93%; Mouse: 93%; Bovine: 86%; Pig: 77%; Horse: 77%; Rabbit: 77%; Guinea pig: 77%