Antibodies

Jump to Filters
View as table Download
KRTCAP2 (C-term) Rabbit Polyclonal Antibody
AP52430PU-N

USD 450.00

2 Weeks

KRTCAP2 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 131-162 amino acids from the C-terminal region of human KTAP2
KRTCAP2 Rabbit Polyclonal Antibody
TA337405

USD 375.00

5 Days

Rabbit Polyclonal Anti-KRTCAP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-KRTCAP2 antibody is: synthetic peptide directed towards the C-terminal region of Human KRTCAP2. Synthetic peptide located within the following region: GLIHRVCVTTCFIFSMVGLYYINKISSTLYQAAAPVLTPAKVTGKSKKRN