KRTCAP2 Rabbit Polyclonal Antibody

CAT#: TA337405

Rabbit Polyclonal Anti-KRTCAP2 Antibody

Product Images

Host: Rabbit; Target Name: KRTCAP2; Sample Tissue: Jurkat Whole Cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-KRTCAP2 antibody is: synthetic peptide directed towards the C-terminal region of Human KRTCAP2. Synthetic peptide located within the following region: GLIHRVCVTTCFIFSMVGLYYINKISSTLYQAAAPVLTPAKVTGKSKKRN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 17 kDa
• Gene Name: keratinocyte associated protein 2
• Database Link:
  NP_776251
  Entrez Gene 200185 Human
  UniProt ID Q8N6L1
• Background: The function of this protein remains unknown.
• Synonyms: KCP2
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Mouse: 86%; Guinea pig: 79%

Reference Data

• Protein Families: Transmembrane