Antibodies

Jump to Filters
View as table Download
LCMT2 Rabbit Polyclonal Antibody
TA346775

USD 475.00

5 Days

Rabbit Polyclonal Anti-LCMT2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LCMT2 antibody: synthetic peptide directed towards the C terminal of human LCMT2. Synthetic peptide located within the following region: PVLSDWHFLHVGTMAWVRIPVEGEVPEARHSHSACTWQGGALIAGGLGAS
LCMT2 Rabbit Polyclonal Antibody
TA319792

USD 430.00

5 Days

Rabbit Polyclonal TYW4 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen TYW4 antibody was raised against a 16 amino acid synthetic peptide near the amino terminus of human TYW4.
LCMT2 Rabbit Polyclonal Antibody
TA365906

USD 380.00

4 Weeks

LCMT2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human LCMT2
LCMT2 Rabbit Polyclonal Antibody
TA370254

USD 380.00

4 Weeks

LCMT2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human LCMT2