LCMT2 Rabbit Polyclonal Antibody

CAT#: TA346775

Rabbit Polyclonal Anti-LCMT2 Antibody

Product Images

WB Suggested Anti-LCMT2 Antibody Titration: 0.2-1 ug/ml; Positive Control: Hela cell lysate; LCMT2 is supported by BioGPS gene expression data to be expressed in HeLa

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-LCMT2 antibody: synthetic peptide directed towards the C terminal of human LCMT2. Synthetic peptide located within the following region: PVLSDWHFLHVGTMAWVRIPVEGEVPEARHSHSACTWQGGALIAGGLGAS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 75 kDa
• Gene Name: leucine carboxyl methyltransferase 2
• Database Link:
  NP_055608
  Entrez Gene 9836 Human
  UniProt ID O60294
• Background: The protein encoded by this intronless gene belongs to the highly variable methyltransferase superfamily. This gene is the inferred homolog of the Saccharomyces cerevisiae carboxymethyltransferase gene PPM2 that is essential for the synthesis of the hypermodified guanosine Wybutosine (yW). [provided by RefSeq, Jul 2008]
• Synonyms: PPM2; TYW4
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 86%; Pig: 86%; Rat: 86%; Horse: 86%; Bovine: 86%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Alzheimer's disease, Androgen and estrogen metabolism, Cardiac muscle contraction, Histidine metabolism, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease, Selenoamino acid metabolism, Tyrosine metabolism